Placeholder image of a protein
Icon representing a puzzle

2140: Revisiting Puzzle 137: Rosetta Decoy

Closed since almost 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
April 28, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups


  1. Avatar for Team China 11. Team China 2 pts. 10,145
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 10,034
  3. Avatar for Beta Folders 13. Beta Folders 1 pt. 9,996
  4. Avatar for Coastal Biochemistry 14. Coastal Biochemistry 1 pt. 9,993
  5. Avatar for CHE222 1 15. CHE222 1 1 pt. 9,349
  6. Avatar for test 2 16. test 2 1 pt. 8,533
  7. Avatar for Window Group 17. Window Group 1 pt. 8,456
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 8,438

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,903
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 96 pts. 11,768
  3. Avatar for christioanchauvin 3. christioanchauvin Lv 1 92 pts. 11,714
  4. Avatar for dcrwheeler 4. dcrwheeler Lv 1 87 pts. 11,710
  5. Avatar for Skippysk8s 5. Skippysk8s Lv 1 83 pts. 11,639
  6. Avatar for MicElephant 6. MicElephant Lv 1 79 pts. 11,629
  7. Avatar for jausmh 7. jausmh Lv 1 76 pts. 11,625
  8. Avatar for jobo0502 8. jobo0502 Lv 1 72 pts. 11,621
  9. Avatar for Idiotboy 9. Idiotboy Lv 1 69 pts. 11,616
  10. Avatar for Galaxie 10. Galaxie Lv 1 65 pts. 11,599

Comments