Placeholder image of a protein
Icon representing a puzzle

2140: Revisiting Puzzle 137: Rosetta Decoy

Closed since almost 4 years ago

Novice Overall Prediction

Summary


Created
April 28, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups


  1. Avatar for Team China 11. Team China 2 pts. 10,145
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 10,034
  3. Avatar for Beta Folders 13. Beta Folders 1 pt. 9,996
  4. Avatar for Coastal Biochemistry 14. Coastal Biochemistry 1 pt. 9,993
  5. Avatar for CHE222 1 15. CHE222 1 1 pt. 9,349
  6. Avatar for test 2 16. test 2 1 pt. 8,533
  7. Avatar for Window Group 17. Window Group 1 pt. 8,456
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 8,438

  1. Avatar for furi0us 91. furi0us Lv 1 1 pt. 9,873
  2. Avatar for Chingachgook727 92. Chingachgook727 Lv 1 1 pt. 9,595
  3. Avatar for Andrew pro 93. Andrew pro Lv 1 1 pt. 9,554
  4. Avatar for GorgunSudeEzgi22 94. GorgunSudeEzgi22 Lv 1 1 pt. 9,349
  5. Avatar for RockOn 95. RockOn Lv 1 1 pt. 8,864
  6. Avatar for joshtest01 96. joshtest01 Lv 1 1 pt. 8,533
  7. Avatar for jflat06 97. jflat06 Lv 1 1 pt. 8,456
  8. Avatar for bkoep 98. bkoep Lv 1 1 pt. 8,438
  9. Avatar for gransom 99. gransom Lv 1 1 pt. 8,438
  10. Avatar for 41922091 100. 41922091 Lv 1 1 pt. 8,438

Comments