Placeholder image of a protein
Icon representing a puzzle

2140: Revisiting Puzzle 137: Rosetta Decoy

Closed since about 4 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 28, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,903
  2. Avatar for Go Science 2. Go Science 74 pts. 11,768
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 54 pts. 11,714
  4. Avatar for Gargleblasters 4. Gargleblasters 38 pts. 11,639
  5. Avatar for Contenders 5. Contenders 27 pts. 11,629
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 11,627
  7. Avatar for GENE 433 7. GENE 433 12 pts. 10,965
  8. Avatar for Australia 8. Australia 8 pts. 10,757
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 10,619
  10. Avatar for Trinity Biology 10. Trinity Biology 3 pts. 10,265

  1. Avatar for furi0us 91. furi0us Lv 1 1 pt. 9,873
  2. Avatar for Chingachgook727 92. Chingachgook727 Lv 1 1 pt. 9,595
  3. Avatar for Andrew pro 93. Andrew pro Lv 1 1 pt. 9,554
  4. Avatar for GorgunSudeEzgi22 94. GorgunSudeEzgi22 Lv 1 1 pt. 9,349
  5. Avatar for RockOn 95. RockOn Lv 1 1 pt. 8,864
  6. Avatar for joshtest01 96. joshtest01 Lv 1 1 pt. 8,533
  7. Avatar for jflat06 97. jflat06 Lv 1 1 pt. 8,456
  8. Avatar for bkoep 98. bkoep Lv 1 1 pt. 8,438
  9. Avatar for gransom 99. gransom Lv 1 1 pt. 8,438
  10. Avatar for Isaac52 100. Isaac52 Lv 1 1 pt. 8,438

Comments