Placeholder image of a protein
Icon representing a puzzle

2140: Revisiting Puzzle 137: Rosetta Decoy

Closed since almost 4 years ago

Novice Overall Prediction

Summary

Created
April 28, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups

  1. Avatar for Team China 11. Team China 2 pts. 10,145
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 10,034
  3. Avatar for Beta Folders 13. Beta Folders 1 pt. 9,996
  4. Avatar for Coastal Biochemistry 14. Coastal Biochemistry 1 pt. 9,993
  5. Avatar for CHE222 1 15. CHE222 1 1 pt. 9,349
  6. Avatar for test 2 16. test 2 1 pt. 8,533
  7. Avatar for Window Group 17. Window Group 1 pt. 8,456
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 8,438
  1. Avatar for Dr.Sillem 71. Dr.Sillem Lv 1 1 pt. 10,339
  2. Avatar for DScott 72. DScott Lv 1 1 pt. 10,311
  3. Avatar for zbp 73. zbp Lv 1 1 pt. 10,302
  4. Avatar for alyssa_d_V2.0 74. alyssa_d_V2.0 Lv 1 1 pt. 10,265
  5. Avatar for Mohoernchen 75. Mohoernchen Lv 1 1 pt. 10,260
  6. Avatar for antibot215 76. antibot215 Lv 1 1 pt. 10,211
  7. Avatar for cjddig 77. cjddig Lv 1 1 pt. 10,181
  8. Avatar for abiogenesis 78. abiogenesis Lv 1 1 pt. 10,172
  9. Avatar for kitsoune 79. kitsoune Lv 1 1 pt. 10,172
  10. Avatar for artsyambie6 80. artsyambie6 Lv 1 1 pt. 10,169

Comments