Placeholder image of a protein
Icon representing a puzzle

2140: Revisiting Puzzle 137: Rosetta Decoy

Closed since almost 4 years ago

Novice Overall Prediction

Summary

Created
April 28, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,903
  2. Avatar for Go Science 2. Go Science 74 pts. 11,768
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 54 pts. 11,714
  4. Avatar for Gargleblasters 4. Gargleblasters 38 pts. 11,639
  5. Avatar for Contenders 5. Contenders 27 pts. 11,629
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 11,627
  7. Avatar for GENE 433 7. GENE 433 12 pts. 10,965
  8. Avatar for Australia 8. Australia 8 pts. 10,757
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 10,619
  10. Avatar for Trinity Biology 10. Trinity Biology 3 pts. 10,265
  1. Avatar for Dr.Sillem 71. Dr.Sillem Lv 1 1 pt. 10,339
  2. Avatar for DScott 72. DScott Lv 1 1 pt. 10,311
  3. Avatar for zbp 73. zbp Lv 1 1 pt. 10,302
  4. Avatar for alyssa_d_V2.0 74. alyssa_d_V2.0 Lv 1 1 pt. 10,265
  5. Avatar for Mohoernchen 75. Mohoernchen Lv 1 1 pt. 10,260
  6. Avatar for antibot215 76. antibot215 Lv 1 1 pt. 10,211
  7. Avatar for cjddig 77. cjddig Lv 1 1 pt. 10,181
  8. Avatar for abiogenesis 78. abiogenesis Lv 1 1 pt. 10,172
  9. Avatar for kitsoune 79. kitsoune Lv 1 1 pt. 10,172
  10. Avatar for artsyambie6 80. artsyambie6 Lv 1 1 pt. 10,169

Comments