Placeholder image of a protein
Icon representing a puzzle

2140: Revisiting Puzzle 137: Rosetta Decoy

Closed since almost 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
April 28, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups


  1. Avatar for Team China 11. Team China 2 pts. 10,145
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 10,034
  3. Avatar for Beta Folders 13. Beta Folders 1 pt. 9,996
  4. Avatar for Coastal Biochemistry 14. Coastal Biochemistry 1 pt. 9,993
  5. Avatar for CHE222 1 15. CHE222 1 1 pt. 9,349
  6. Avatar for test 2 16. test 2 1 pt. 8,533
  7. Avatar for Window Group 17. Window Group 1 pt. 8,456
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 8,438

  1. Avatar for jimweng 81. jimweng Lv 1 1 pt. 10,145
  2. Avatar for mwm64 82. mwm64 Lv 1 1 pt. 10,128
  3. Avatar for marqho 83. marqho Lv 1 1 pt. 10,104
  4. Avatar for zo3xiaJonWeinberg 84. zo3xiaJonWeinberg Lv 1 1 pt. 10,069
  5. Avatar for AlphaFold2 85. AlphaFold2 Lv 1 1 pt. 10,034
  6. Avatar for tracybutt 86. tracybutt Lv 1 1 pt. 9,996
  7. Avatar for emmacatlett 87. emmacatlett Lv 1 1 pt. 9,993
  8. Avatar for Rose621 88. Rose621 Lv 1 1 pt. 9,896
  9. Avatar for M Siegrist 89. M Siegrist Lv 1 1 pt. 9,893
  10. Avatar for mcg70958 90. mcg70958 Lv 1 1 pt. 9,877

Comments