Placeholder image of a protein
Icon representing a puzzle

2140: Revisiting Puzzle 137: Rosetta Decoy

Closed since almost 4 years ago

Novice Overall Prediction

Summary

Created
April 28, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,903
  2. Avatar for Go Science 2. Go Science 74 pts. 11,768
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 54 pts. 11,714
  4. Avatar for Gargleblasters 4. Gargleblasters 38 pts. 11,639
  5. Avatar for Contenders 5. Contenders 27 pts. 11,629
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 11,627
  7. Avatar for GENE 433 7. GENE 433 12 pts. 10,965
  8. Avatar for Australia 8. Australia 8 pts. 10,757
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 10,619
  10. Avatar for Trinity Biology 10. Trinity Biology 3 pts. 10,265
  1. Avatar for jimweng 81. jimweng Lv 1 1 pt. 10,145
  2. Avatar for mwm64 82. mwm64 Lv 1 1 pt. 10,128
  3. Avatar for marqho 83. marqho Lv 1 1 pt. 10,104
  4. Avatar for zo3xiaJonWeinberg 84. zo3xiaJonWeinberg Lv 1 1 pt. 10,069
  5. Avatar for AlphaFold2 85. AlphaFold2 Lv 1 1 pt. 10,034
  6. Avatar for tracybutt 86. tracybutt Lv 1 1 pt. 9,996
  7. Avatar for emmacatlett 87. emmacatlett Lv 1 1 pt. 9,993
  8. Avatar for Rose621 88. Rose621 Lv 1 1 pt. 9,896
  9. Avatar for M Siegrist 89. M Siegrist Lv 1 1 pt. 9,893
  10. Avatar for mcg70958 90. mcg70958 Lv 1 1 pt. 9,877

Comments