Placeholder image of a protein
Icon representing a puzzle

2164: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since almost 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
June 23, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,930
  2. Avatar for Go Science 2. Go Science 68 pts. 11,784
  3. Avatar for Marvin's bunch 3. Marvin's bunch 44 pts. 11,722
  4. Avatar for Contenders 4. Contenders 27 pts. 11,711
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 11,606
  6. Avatar for Gargleblasters 6. Gargleblasters 9 pts. 11,297
  7. Avatar for Australia 7. Australia 5 pts. 10,910
  8. Avatar for METU-BIN 8. METU-BIN 3 pts. 10,844
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,669
  10. Avatar for Team China 10. Team China 1 pt. 10,524

  1. Avatar for carxo 61. carxo Lv 1 1 pt. 10,270
  2. Avatar for Larini 62. Larini Lv 1 1 pt. 10,162
  3. Avatar for Dr.Sillem 63. Dr.Sillem Lv 1 1 pt. 10,152
  4. Avatar for kevin everington 64. kevin everington Lv 1 1 pt. 10,101
  5. Avatar for Mohoernchen 65. Mohoernchen Lv 1 1 pt. 10,091
  6. Avatar for antibot215 66. antibot215 Lv 1 1 pt. 10,078
  7. Avatar for r-blaze 67. r-blaze Lv 1 1 pt. 9,982
  8. Avatar for tracybutt 68. tracybutt Lv 1 1 pt. 9,931
  9. Avatar for pruneau_44 69. pruneau_44 Lv 1 1 pt. 9,930
  10. Avatar for Sammy3c2b1a0 70. Sammy3c2b1a0 Lv 1 1 pt. 9,907

Comments