Placeholder image of a protein
Icon representing a puzzle

2164: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since almost 4 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 23, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,930
  2. Avatar for Go Science 2. Go Science 68 pts. 11,784
  3. Avatar for Marvin's bunch 3. Marvin's bunch 44 pts. 11,722
  4. Avatar for Contenders 4. Contenders 27 pts. 11,711
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 11,606
  6. Avatar for Gargleblasters 6. Gargleblasters 9 pts. 11,297
  7. Avatar for Australia 7. Australia 5 pts. 10,910
  8. Avatar for METU-BIN 8. METU-BIN 3 pts. 10,844
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,669
  10. Avatar for Team China 10. Team China 1 pt. 10,524

  1. Avatar for Lee Chun Ming 72. Lee Chun Ming Lv 1 1 pt. 9,885
  2. Avatar for heyubob 73. heyubob Lv 1 1 pt. 9,874
  3. Avatar for furi0us 74. furi0us Lv 1 1 pt. 9,793
  4. Avatar for chcoboy77 75. chcoboy77 Lv 1 1 pt. 9,786
  5. Avatar for AlphaFold2 76. AlphaFold2 Lv 1 1 pt. 9,783
  6. Avatar for dilaraozden 77. dilaraozden Lv 1 1 pt. 9,697
  7. Avatar for denizcbk 78. denizcbk Lv 1 1 pt. 9,626
  8. Avatar for walterdug 79. walterdug Lv 1 1 pt. 9,610
  9. Avatar for bkoep 80. bkoep Lv 1 1 pt. 9,069

Comments