Placeholder image of a protein
Icon representing a puzzle

2164: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
June 23, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,930
  2. Avatar for Go Science 2. Go Science 68 pts. 11,784
  3. Avatar for Marvin's bunch 3. Marvin's bunch 44 pts. 11,722
  4. Avatar for Contenders 4. Contenders 27 pts. 11,711
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 11,606
  6. Avatar for Gargleblasters 6. Gargleblasters 9 pts. 11,297
  7. Avatar for Australia 7. Australia 5 pts. 10,910
  8. Avatar for METU-BIN 8. METU-BIN 3 pts. 10,844
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,669
  10. Avatar for Team China 10. Team China 1 pt. 10,524
  1. Avatar for bamh 41. bamh Lv 1 5 pts. 11,000
  2. Avatar for Beany 42. Beany Lv 1 4 pts. 10,974
  3. Avatar for Crossed Sticks 43. Crossed Sticks Lv 1 4 pts. 10,959
  4. Avatar for Wiz kid 44. Wiz kid Lv 1 4 pts. 10,910
  5. Avatar for CharaLilith 45. CharaLilith Lv 1 3 pts. 10,898
  6. Avatar for Deleted player 46. Deleted player pts. 10,846
  7. Avatar for yabuzhan 47. yabuzhan Lv 1 3 pts. 10,844
  8. Avatar for abiogenesis 48. abiogenesis Lv 1 2 pts. 10,825
  9. Avatar for kyoota 49. kyoota Lv 1 2 pts. 10,778
  10. Avatar for Oransche 50. Oransche Lv 1 2 pts. 10,745

Comments