Placeholder image of a protein
Icon representing a puzzle

2164: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
June 23, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,930
  2. Avatar for Go Science 2. Go Science 68 pts. 11,784
  3. Avatar for Marvin's bunch 3. Marvin's bunch 44 pts. 11,722
  4. Avatar for Contenders 4. Contenders 27 pts. 11,711
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 11,606
  6. Avatar for Gargleblasters 6. Gargleblasters 9 pts. 11,297
  7. Avatar for Australia 7. Australia 5 pts. 10,910
  8. Avatar for METU-BIN 8. METU-BIN 3 pts. 10,844
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,669
  10. Avatar for Team China 10. Team China 1 pt. 10,524
  1. Avatar for JeffreyCohen 81. JeffreyCohen Lv 1 1 pt. 8,662
  2. Avatar for studente1 82. studente1 Lv 1 1 pt. 8,653
  3. Avatar for zo3xiaJonWeinberg 83. zo3xiaJonWeinberg Lv 1 1 pt. 8,561
  4. Avatar for naniewoo 84. naniewoo Lv 1 1 pt. 8,561
  5. Avatar for apetrides 85. apetrides Lv 1 1 pt. 8,561
  6. Avatar for hkn 86. hkn Lv 1 1 pt. 8,561
  7. Avatar for Sciren 87. Sciren Lv 1 1 pt. 8,561

Comments