2176: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since over 3 years ago

Summary

• Created: July 21, 2022
• Expires: July 28, 2022 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups

• 1. Anthropic Dreams 100 pts. 9,879
• 2. Go Science 60 pts. 9,698
• 3. Contenders 33 pts. 9,694
• 4. L'Alliance Francophone 17 pts. 9,669
• 5. Gargleblasters 8 pts. 9,648
• 6. Void Crushers 4 pts. 9,594
• 7. Marvin's bunch 2 pts. 9,578
• 8. Australia 1 pt. 9,350
• 9. SETI.Germany 1 pt. 9,346
• 10. Beta Folders 1 pt. 9,221

Top soloists

• 11. Pazithi 53 pts. 9,648
• 12. SemperRabbit 50 pts. 9,644
• 13. ucad 46 pts. 9,638
• 14. g_b 43 pts. 9,629
• 15. maithra 40 pts. 9,620
• 16. BootsMcGraw 37 pts. 9,616
• 17. alcor29 35 pts. 9,607
• 18. ZeroLeak7 32 pts. 9,597
• 19. Anfinsen_slept_here 30 pts. 9,594
• 20. firejuggler 28 pts. 9,594