Placeholder image of a protein
Icon representing a puzzle

2176: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
July 21, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,879
  2. Avatar for Go Science 2. Go Science 60 pts. 9,698
  3. Avatar for Contenders 3. Contenders 33 pts. 9,694
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 17 pts. 9,669
  5. Avatar for Gargleblasters 5. Gargleblasters 8 pts. 9,648
  6. Avatar for Void Crushers 6. Void Crushers 4 pts. 9,594
  7. Avatar for Marvin's bunch 7. Marvin's bunch 2 pts. 9,578
  8. Avatar for Australia 8. Australia 1 pt. 9,350
  9. Avatar for SETI.Germany 9. SETI.Germany 1 pt. 9,346
  10. Avatar for Beta Folders 10. Beta Folders 1 pt. 9,221
  1. Avatar for Wiz kid 51. Wiz kid Lv 1 1 pt. 9,291
  2. Avatar for Crossed Sticks 52. Crossed Sticks Lv 1 1 pt. 9,264
  3. Avatar for CharaLilith 53. CharaLilith Lv 1 1 pt. 9,246
  4. Avatar for naniewoo 54. naniewoo Lv 1 1 pt. 9,242
  5. Avatar for Gonegirl 55. Gonegirl Lv 1 1 pt. 9,240
  6. Avatar for tracybutt 56. tracybutt Lv 1 1 pt. 9,221
  7. Avatar for a5hm0r 57. a5hm0r Lv 1 1 pt. 9,212
  8. Avatar for DScott 58. DScott Lv 1 1 pt. 9,193
  9. Avatar for Larini 59. Larini Lv 1 1 pt. 9,188
  10. Avatar for Dr.Sillem 60. Dr.Sillem Lv 1 1 pt. 9,174

Comments