Placeholder image of a protein
Icon representing a puzzle

2176: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since almost 4 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 21, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,879
  2. Avatar for Go Science 2. Go Science 60 pts. 9,698
  3. Avatar for Contenders 3. Contenders 33 pts. 9,694
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 17 pts. 9,669
  5. Avatar for Gargleblasters 5. Gargleblasters 8 pts. 9,648
  6. Avatar for Void Crushers 6. Void Crushers 4 pts. 9,594
  7. Avatar for Marvin's bunch 7. Marvin's bunch 2 pts. 9,578
  8. Avatar for Australia 8. Australia 1 pt. 9,350
  9. Avatar for SETI.Germany 9. SETI.Germany 1 pt. 9,346
  10. Avatar for Beta Folders 10. Beta Folders 1 pt. 9,221

  1. Avatar for cjddig 71. cjddig Lv 1 1 pt. 8,951
  2. Avatar for furi0us 72. furi0us Lv 1 1 pt. 8,942
  3. Avatar for Sarion5 73. Sarion5 Lv 1 1 pt. 8,916
  4. Avatar for Merf 74. Merf Lv 1 1 pt. 8,912
  5. Avatar for mwm64 75. mwm64 Lv 1 1 pt. 8,859
  6. Avatar for robgee 76. robgee Lv 1 1 pt. 8,856
  7. Avatar for yhl 77. yhl Lv 1 1 pt. 8,334
  8. Avatar for Zafira765 78. Zafira765 Lv 1 1 pt. 8,317
  9. Avatar for sdlerm 79. sdlerm Lv 1 1 pt. 8,277
  10. Avatar for jhrcwms 80. jhrcwms Lv 1 1 pt. 8,277

Comments