Placeholder image of a protein
Icon representing a puzzle

2179: Electron Density Reconstruction 11

Closed since over 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
July 28, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


KELVLVLYDYQEKSPREVTVKKGDILTLLNSTNKDWWKVEVDDRQGFIPAAYLKKLD

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 12,881
  2. Avatar for Beta Folders 12. Beta Folders 1 pt. 12,735
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 12,626
  4. Avatar for Team China 14. Team China 1 pt. 12,424
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,346
  1. Avatar for gmn 11. gmn Lv 1 56 pts. 13,140
  2. Avatar for g_b 12. g_b Lv 1 53 pts. 13,139
  3. Avatar for dcrwheeler 13. dcrwheeler Lv 1 50 pts. 13,139
  4. Avatar for akaaka 14. akaaka Lv 1 47 pts. 13,137
  5. Avatar for MicElephant 15. MicElephant Lv 1 44 pts. 13,130
  6. Avatar for Calimero Sombrero 16. Calimero Sombrero Lv 1 41 pts. 13,111
  7. Avatar for jobo0502 17. jobo0502 Lv 1 39 pts. 13,104
  8. Avatar for BackBuffer 18. BackBuffer Lv 1 36 pts. 13,100
  9. Avatar for Deleted player 19. Deleted player 34 pts. 13,099
  10. Avatar for SemperRabbit 20. SemperRabbit Lv 1 32 pts. 13,098

Comments

LociOiling Lv 1

Once again, we are promised a glutathione ligand, but the puzzle fails to deliver.

Electron Density Reconstruction 6, puzzle 2120, was the same deal.

Thanks to zo3xiaJonWeinberg for noticing the gap this time around.