Placeholder image of a protein
Icon representing a puzzle

2179: Electron Density Reconstruction 11

Closed since over 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
July 28, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


KELVLVLYDYQEKSPREVTVKKGDILTLLNSTNKDWWKVEVDDRQGFIPAAYLKKLD

Top groups


  1. Avatar for Australia 11. Australia 1 pt. 12,881
  2. Avatar for Beta Folders 12. Beta Folders 1 pt. 12,735
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 12,626
  4. Avatar for Team China 14. Team China 1 pt. 12,424
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,346

  1. Avatar for Bruno Kestemont 21. Bruno Kestemont Lv 1 29 pts. 13,094
  2. Avatar for manu8170 22. manu8170 Lv 1 27 pts. 13,082
  3. Avatar for fpc 23. fpc Lv 1 26 pts. 13,081
  4. Avatar for zippyc137 24. zippyc137 Lv 1 24 pts. 13,081
  5. Avatar for Pazithi 25. Pazithi Lv 1 22 pts. 13,076
  6. Avatar for equilibria 26. equilibria Lv 1 21 pts. 13,075
  7. Avatar for alcor29 27. alcor29 Lv 1 19 pts. 13,075
  8. Avatar for ichwilldiesennamen 28. ichwilldiesennamen Lv 1 18 pts. 13,062
  9. Avatar for ucad 29. ucad Lv 1 16 pts. 13,052
  10. Avatar for BootsMcGraw 30. BootsMcGraw Lv 1 15 pts. 13,046

Comments


LociOiling Lv 1

Once again, we are promised a glutathione ligand, but the puzzle fails to deliver.

Electron Density Reconstruction 6, puzzle 2120, was the same deal.

Thanks to zo3xiaJonWeinberg for noticing the gap this time around.