Placeholder image of a protein
Icon representing a puzzle

2179: Electron Density Reconstruction 11

Closed since over 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
July 28, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


KELVLVLYDYQEKSPREVTVKKGDILTLLNSTNKDWWKVEVDDRQGFIPAAYLKKLD

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 12,881
  2. Avatar for Beta Folders 12. Beta Folders 1 pt. 12,735
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 12,626
  4. Avatar for Team China 14. Team China 1 pt. 12,424
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,346
  1. Avatar for toshiue 31. toshiue Lv 1 14 pts. 13,042
  2. Avatar for maithra 32. maithra Lv 1 13 pts. 13,037
  3. Avatar for Anfinsen_slept_here 33. Anfinsen_slept_here Lv 1 12 pts. 13,036
  4. Avatar for Lotus23 34. Lotus23 Lv 1 11 pts. 13,035
  5. Avatar for fiendish_ghoul 35. fiendish_ghoul Lv 1 10 pts. 13,025
  6. Avatar for WBarme1234 36. WBarme1234 Lv 1 9 pts. 13,010
  7. Avatar for NeLikomSheet 37. NeLikomSheet Lv 1 9 pts. 13,006
  8. Avatar for phi16 38. phi16 Lv 1 8 pts. 12,997
  9. Avatar for ShadowTactics 39. ShadowTactics Lv 1 7 pts. 12,982
  10. Avatar for rezaefar 40. rezaefar Lv 1 7 pts. 12,979

Comments

LociOiling Lv 1

Once again, we are promised a glutathione ligand, but the puzzle fails to deliver.

Electron Density Reconstruction 6, puzzle 2120, was the same deal.

Thanks to zo3xiaJonWeinberg for noticing the gap this time around.