Placeholder image of a protein
Icon representing a puzzle

2179: Electron Density Reconstruction 11

Closed since over 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
July 28, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


KELVLVLYDYQEKSPREVTVKKGDILTLLNSTNKDWWKVEVDDRQGFIPAAYLKKLD

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 12,881
  2. Avatar for Beta Folders 12. Beta Folders 1 pt. 12,735
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 12,626
  4. Avatar for Team China 14. Team China 1 pt. 12,424
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,346
  1. Avatar for carxo 61. carxo Lv 1 1 pt. 12,781
  2. Avatar for Wiz kid 62. Wiz kid Lv 1 1 pt. 12,772
  3. Avatar for kiwi081999 63. kiwi081999 Lv 1 1 pt. 12,747
  4. Avatar for tracybutt 64. tracybutt Lv 1 1 pt. 12,735
  5. Avatar for OperatorOrville 65. OperatorOrville Lv 1 1 pt. 12,731
  6. Avatar for jausmh 66. jausmh Lv 1 1 pt. 12,723
  7. Avatar for dexterone 67. dexterone Lv 1 1 pt. 12,713
  8. Avatar for rinze 68. rinze Lv 1 1 pt. 12,709
  9. Avatar for Giantbluefish 69. Giantbluefish Lv 1 1 pt. 12,699
  10. Avatar for Hellcat6 70. Hellcat6 Lv 1 1 pt. 12,694

Comments

LociOiling Lv 1

Once again, we are promised a glutathione ligand, but the puzzle fails to deliver.

Electron Density Reconstruction 6, puzzle 2120, was the same deal.

Thanks to zo3xiaJonWeinberg for noticing the gap this time around.