Placeholder image of a protein
Icon representing a puzzle

2179: Electron Density Reconstruction 11

Closed since over 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
July 28, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


KELVLVLYDYQEKSPREVTVKKGDILTLLNSTNKDWWKVEVDDRQGFIPAAYLKKLD

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 12,881
  2. Avatar for Beta Folders 12. Beta Folders 1 pt. 12,735
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 12,626
  4. Avatar for Team China 14. Team China 1 pt. 12,424
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,346
  1. Avatar for mengzach 71. mengzach Lv 1 1 pt. 12,683
  2. Avatar for furi0us 72. furi0us Lv 1 1 pt. 12,678
  3. Avatar for Gematron 2874 73. Gematron 2874 Lv 1 1 pt. 12,676
  4. Avatar for hada 74. hada Lv 1 1 pt. 12,669
  5. Avatar for pruneau_44 75. pruneau_44 Lv 1 1 pt. 12,628
  6. Avatar for dahast.de 76. dahast.de Lv 1 1 pt. 12,626
  7. Avatar for roman madala 77. roman madala Lv 1 1 pt. 12,577
  8. Avatar for dirkjanh 78. dirkjanh Lv 1 1 pt. 12,571
  9. Avatar for spvincent 79. spvincent Lv 1 1 pt. 12,571
  10. Avatar for zo3xiaJonWeinberg 80. zo3xiaJonWeinberg Lv 1 1 pt. 12,424

Comments

LociOiling Lv 1

Once again, we are promised a glutathione ligand, but the puzzle fails to deliver.

Electron Density Reconstruction 6, puzzle 2120, was the same deal.

Thanks to zo3xiaJonWeinberg for noticing the gap this time around.