Placeholder image of a protein
Icon representing a puzzle

2179: Electron Density Reconstruction 11

Closed since over 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
July 28, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


KELVLVLYDYQEKSPREVTVKKGDILTLLNSTNKDWWKVEVDDRQGFIPAAYLKKLD

Top groups


  1. Avatar for Australia 11. Australia 1 pt. 12,881
  2. Avatar for Beta Folders 12. Beta Folders 1 pt. 12,735
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 12,626
  4. Avatar for Team China 14. Team China 1 pt. 12,424
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,346

  1. Avatar for yzqah 81. yzqah Lv 1 1 pt. 12,372
  2. Avatar for rhassunuma 82. rhassunuma Lv 1 1 pt. 12,371
  3. Avatar for robgee 83. robgee Lv 1 1 pt. 12,040
  4. Avatar for MrWandrew 84. MrWandrew Lv 1 1 pt. 11,868
  5. Avatar for sexybunny233 85. sexybunny233 Lv 1 1 pt. 11,861
  6. Avatar for Swapper242 86. Swapper242 Lv 1 1 pt. 11,833
  7. Avatar for Federiko 87. Federiko Lv 1 1 pt. 10,240
  8. Avatar for rosethornranger2 88. rosethornranger2 Lv 1 1 pt. 10,240
  9. Avatar for mwm64 89. mwm64 Lv 1 1 pt. 9,681
  10. Avatar for vickylone 90. vickylone Lv 1 1 pt. 7,792

Comments


LociOiling Lv 1

Once again, we are promised a glutathione ligand, but the puzzle fails to deliver.

Electron Density Reconstruction 6, puzzle 2120, was the same deal.

Thanks to zo3xiaJonWeinberg for noticing the gap this time around.