Placeholder image of a protein
Icon representing a puzzle

2182: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
August 04, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 10,392
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 10,319
  1. Avatar for Sandrix72 11. Sandrix72 Lv 1 55 pts. 11,902
  2. Avatar for gmn 12. gmn Lv 1 52 pts. 11,896
  3. Avatar for Timo van der Laan 13. Timo van der Laan Lv 1 49 pts. 11,886
  4. Avatar for guineapig 14. guineapig Lv 1 45 pts. 11,885
  5. Avatar for ichwilldiesennamen 15. ichwilldiesennamen Lv 1 43 pts. 11,866
  6. Avatar for WBarme1234 16. WBarme1234 Lv 1 40 pts. 11,833
  7. Avatar for BackBuffer 17. BackBuffer Lv 1 37 pts. 11,808
  8. Avatar for Idiotboy 18. Idiotboy Lv 1 35 pts. 11,801
  9. Avatar for Punzi Baker 3 19. Punzi Baker 3 Lv 1 32 pts. 11,796
  10. Avatar for maithra 20. maithra Lv 1 30 pts. 11,792

Comments