Placeholder image of a protein
Icon representing a puzzle

2182: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
August 04, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 10,392
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 10,319
  1. Avatar for NPrincipi 31. NPrincipi Lv 1 13 pts. 11,550
  2. Avatar for ProfVince 32. ProfVince Lv 1 12 pts. 11,541
  3. Avatar for Beany 33. Beany Lv 1 11 pts. 11,532
  4. Avatar for MrZanav 34. MrZanav Lv 1 10 pts. 11,491
  5. Avatar for heather-1 35. heather-1 Lv 1 9 pts. 11,464
  6. Avatar for Zhang Ruichong 36. Zhang Ruichong Lv 1 8 pts. 11,449
  7. Avatar for Lotus23 37. Lotus23 Lv 1 8 pts. 11,344
  8. Avatar for equilibria 38. equilibria Lv 1 7 pts. 11,340
  9. Avatar for rezaefar 39. rezaefar Lv 1 6 pts. 11,332
  10. Avatar for ucad 40. ucad Lv 1 6 pts. 11,294

Comments