Placeholder image of a protein
Icon representing a puzzle

2182: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
August 04, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 10,392
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 10,319
  1. Avatar for robgee 81. robgee Lv 1 1 pt. 10,085
  2. Avatar for Swapper242 82. Swapper242 Lv 1 1 pt. 10,049
  3. Avatar for furi0us 83. furi0us Lv 1 1 pt. 10,048
  4. Avatar for ThatCouple 84. ThatCouple Lv 1 1 pt. 9,905
  5. Avatar for chcoboy77 85. chcoboy77 Lv 1 1 pt. 9,747
  6. Avatar for mwm64 86. mwm64 Lv 1 1 pt. 9,444
  7. Avatar for amiralisoltanine 87. amiralisoltanine Lv 1 1 pt. 8,774
  8. Avatar for cbwest 88. cbwest Lv 1 1 pt. 8,656
  9. Avatar for Hellcat6 89. Hellcat6 Lv 1 1 pt. 8,656

Comments