Placeholder image of a protein
Icon representing a puzzle

2185: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
August 11, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 10,846
  2. Avatar for Beta Folders 12. Beta Folders 1 pt. 10,825
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 10,549
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 10,276
  5. Avatar for Window Group 15. Window Group 1 pt. 9,090
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,598
  2. Avatar for NinjaGreg 2. NinjaGreg Lv 1 95 pts. 11,495
  3. Avatar for Idiotboy 3. Idiotboy Lv 1 90 pts. 11,442
  4. Avatar for Aubade01 4. Aubade01 Lv 1 85 pts. 11,424
  5. Avatar for jobo0502 5. jobo0502 Lv 1 81 pts. 11,405
  6. Avatar for gmn 6. gmn Lv 1 76 pts. 11,404
  7. Avatar for Galaxie 7. Galaxie Lv 1 72 pts. 11,403
  8. Avatar for MicElephant 8. MicElephant Lv 1 68 pts. 11,383
  9. Avatar for Punzi Baker 3 9. Punzi Baker 3 Lv 1 64 pts. 11,382
  10. Avatar for Sandrix72 10. Sandrix72 Lv 1 61 pts. 11,374

Comments