Placeholder image of a protein
Icon representing a puzzle

2185: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since over 3 years ago

Novice Overall Prediction

Summary


Created
August 11, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,600
  2. Avatar for Go Science 2. Go Science 70 pts. 11,495
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 47 pts. 11,405
  4. Avatar for Contenders 4. Contenders 30 pts. 11,383
  5. Avatar for Void Crushers 5. Void Crushers 19 pts. 11,368
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 11,334
  7. Avatar for BOINC@Poland 7. BOINC@Poland 7 pts. 11,129
  8. Avatar for WISE 380 Spring 21 A 8. WISE 380 Spring 21 A 4 pts. 10,985
  9. Avatar for Gargleblasters 9. Gargleblasters 2 pts. 10,943
  10. Avatar for Team China 10. Team China 1 pt. 10,862

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,598
  2. Avatar for NinjaGreg 2. NinjaGreg Lv 1 95 pts. 11,495
  3. Avatar for Idiotboy 3. Idiotboy Lv 1 90 pts. 11,442
  4. Avatar for Aubade01 4. Aubade01 Lv 1 85 pts. 11,424
  5. Avatar for jobo0502 5. jobo0502 Lv 1 81 pts. 11,405
  6. Avatar for gmn 6. gmn Lv 1 76 pts. 11,404
  7. Avatar for Galaxie 7. Galaxie Lv 1 72 pts. 11,403
  8. Avatar for MicElephant 8. MicElephant Lv 1 68 pts. 11,383
  9. Avatar for Punzi Baker 3 9. Punzi Baker 3 Lv 1 64 pts. 11,382
  10. Avatar for Sandrix72 10. Sandrix72 Lv 1 61 pts. 11,374

Comments