Placeholder image of a protein
Icon representing a puzzle

2185: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since almost 4 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 11, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups


  1. Avatar for Australia 11. Australia 1 pt. 10,846
  2. Avatar for Beta Folders 12. Beta Folders 1 pt. 10,825
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 10,549
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 10,276
  5. Avatar for Window Group 15. Window Group 1 pt. 9,090

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 11,600
  2. Avatar for LociOiling 2. LociOiling Lv 1 65 pts. 11,598
  3. Avatar for gmn 3. gmn Lv 1 41 pts. 11,586
  4. Avatar for phi16 4. phi16 Lv 1 24 pts. 11,575
  5. Avatar for alcor29 5. alcor29 Lv 1 14 pts. 11,575
  6. Avatar for MrZanav 6. MrZanav Lv 1 7 pts. 11,562
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 4 pts. 11,445
  8. Avatar for kyoota 8. kyoota Lv 1 2 pts. 11,430
  9. Avatar for Sandrix72 9. Sandrix72 Lv 1 1 pt. 11,413
  10. Avatar for maithra 10. maithra Lv 1 1 pt. 11,366

Comments