Placeholder image of a protein
Icon representing a puzzle

2185: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
August 11, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,600
  2. Avatar for Go Science 2. Go Science 70 pts. 11,495
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 47 pts. 11,405
  4. Avatar for Contenders 4. Contenders 30 pts. 11,383
  5. Avatar for Void Crushers 5. Void Crushers 19 pts. 11,368
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 11,334
  7. Avatar for BOINC@Poland 7. BOINC@Poland 7 pts. 11,129
  8. Avatar for WISE 380 Spring 21 A 8. WISE 380 Spring 21 A 4 pts. 10,985
  9. Avatar for Gargleblasters 9. Gargleblasters 2 pts. 10,943
  10. Avatar for Team China 10. Team China 1 pt. 10,862
  1. Avatar for guineapig 11. guineapig Lv 1 1 pt. 11,319
  2. Avatar for MicElephant 12. MicElephant Lv 1 1 pt. 11,313
  3. Avatar for CharaLilith 13. CharaLilith Lv 1 1 pt. 10,685

Comments