Placeholder image of a protein
Icon representing a puzzle

2185: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
August 11, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,600
  2. Avatar for Go Science 2. Go Science 70 pts. 11,495
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 47 pts. 11,405
  4. Avatar for Contenders 4. Contenders 30 pts. 11,383
  5. Avatar for Void Crushers 5. Void Crushers 19 pts. 11,368
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 11,334
  7. Avatar for BOINC@Poland 7. BOINC@Poland 7 pts. 11,129
  8. Avatar for WISE 380 Spring 21 A 8. WISE 380 Spring 21 A 4 pts. 10,985
  9. Avatar for Gargleblasters 9. Gargleblasters 2 pts. 10,943
  10. Avatar for Team China 10. Team China 1 pt. 10,862
  1. Avatar for manu8170 21. manu8170 Lv 1 30 pts. 11,277
  2. Avatar for grogar7 22. grogar7 Lv 1 28 pts. 11,268
  3. Avatar for akaaka 23. akaaka Lv 1 26 pts. 11,254
  4. Avatar for christioanchauvin 24. christioanchauvin Lv 1 25 pts. 11,236
  5. Avatar for NeLikomSheet 25. NeLikomSheet Lv 1 23 pts. 11,227
  6. Avatar for SemperRabbit 26. SemperRabbit Lv 1 21 pts. 11,216
  7. Avatar for Lotus23 27. Lotus23 Lv 1 20 pts. 11,199
  8. Avatar for WBarme1234 28. WBarme1234 Lv 1 19 pts. 11,194
  9. Avatar for Zosa 29. Zosa Lv 1 17 pts. 11,177
  10. Avatar for infjamc 30. infjamc Lv 1 16 pts. 11,159

Comments