Placeholder image of a protein
Icon representing a puzzle

2188: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
August 18, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for WISE 380 Spring 21 A 11. WISE 380 Spring 21 A 1 pt. 11,335
  2. Avatar for Australia 12. Australia 1 pt. 11,308
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,929
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,949
  1. Avatar for alcor29 21. alcor29 Lv 1 27 pts. 11,799
  2. Avatar for ichwilldiesennamen 22. ichwilldiesennamen Lv 1 25 pts. 11,792
  3. Avatar for akaaka 23. akaaka Lv 1 23 pts. 11,790
  4. Avatar for g_b 24. g_b Lv 1 22 pts. 11,734
  5. Avatar for SemperRabbit 25. SemperRabbit Lv 1 20 pts. 11,732
  6. Avatar for dcrwheeler 26. dcrwheeler Lv 1 18 pts. 11,718
  7. Avatar for Lotus23 27. Lotus23 Lv 1 17 pts. 11,711
  8. Avatar for equilibria 28. equilibria Lv 1 16 pts. 11,679
  9. Avatar for maithra 29. maithra Lv 1 14 pts. 11,670
  10. Avatar for PeterDav 30. PeterDav Lv 1 13 pts. 11,649

Comments