Placeholder image of a protein
Icon representing a puzzle

2188: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
August 18, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for WISE 380 Spring 21 A 11. WISE 380 Spring 21 A 1 pt. 11,335
  2. Avatar for Australia 12. Australia 1 pt. 11,308
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,929
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,949
  1. Avatar for Beany 41. Beany Lv 1 5 pts. 11,513
  2. Avatar for CharaLilith 42. CharaLilith Lv 1 4 pts. 11,491
  3. Avatar for tracybutt 43. tracybutt Lv 1 4 pts. 11,480
  4. Avatar for ProfVince 44. ProfVince Lv 1 4 pts. 11,463
  5. Avatar for Oransche 45. Oransche Lv 1 3 pts. 11,461
  6. Avatar for abiogenesis 46. abiogenesis Lv 1 3 pts. 11,458
  7. Avatar for bamh 47. bamh Lv 1 3 pts. 11,450
  8. Avatar for Trajan464 48. Trajan464 Lv 1 2 pts. 11,438
  9. Avatar for fpc 49. fpc Lv 1 2 pts. 11,420
  10. Avatar for Gonegirl 50. Gonegirl Lv 1 2 pts. 11,411

Comments