Placeholder image of a protein
Icon representing a puzzle

2188: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
August 18, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for WISE 380 Spring 21 A 11. WISE 380 Spring 21 A 1 pt. 11,335
  2. Avatar for Australia 12. Australia 1 pt. 11,308
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,929
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,949
  1. Avatar for Larini 61. Larini Lv 1 1 pt. 11,098
  2. Avatar for Arne Heessels 62. Arne Heessels Lv 1 1 pt. 11,062
  3. Avatar for Dr.Sillem 63. Dr.Sillem Lv 1 1 pt. 11,013
  4. Avatar for DScott 64. DScott Lv 1 1 pt. 11,001
  5. Avatar for rinze 65. rinze Lv 1 1 pt. 10,995
  6. Avatar for dahast.de 66. dahast.de Lv 1 1 pt. 10,976
  7. Avatar for MrZanav 67. MrZanav Lv 1 1 pt. 10,972
  8. Avatar for robgee 68. robgee Lv 1 1 pt. 10,945
  9. Avatar for alyssa_d_V2.0 69. alyssa_d_V2.0 Lv 1 1 pt. 10,929
  10. Avatar for Swapper242 70. Swapper242 Lv 1 1 pt. 10,922

Comments