Placeholder image of a protein
Icon representing a puzzle

2188: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
August 18, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for WISE 380 Spring 21 A 11. WISE 380 Spring 21 A 1 pt. 11,335
  2. Avatar for Australia 12. Australia 1 pt. 11,308
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,929
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,949
  1. Avatar for Mohoernchen 71. Mohoernchen Lv 1 1 pt. 10,917
  2. Avatar for momadoc 72. momadoc Lv 1 1 pt. 10,909
  3. Avatar for B. A. Beder 73. B. A. Beder Lv 1 1 pt. 10,906
  4. Avatar for dexterone 74. dexterone Lv 1 1 pt. 10,895
  5. Avatar for sdlerm 75. sdlerm Lv 1 1 pt. 10,882
  6. Avatar for hada 76. hada Lv 1 1 pt. 10,802
  7. Avatar for pruneau_44 77. pruneau_44 Lv 1 1 pt. 10,800
  8. Avatar for Ejhz 78. Ejhz Lv 1 1 pt. 10,791
  9. Avatar for furi0us 79. furi0us Lv 1 1 pt. 10,772
  10. Avatar for Hellcat6 80. Hellcat6 Lv 1 1 pt. 10,684

Comments