Placeholder image of a protein
Icon representing a puzzle

2188: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
August 18, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for WISE 380 Spring 21 A 11. WISE 380 Spring 21 A 1 pt. 11,335
  2. Avatar for Australia 12. Australia 1 pt. 11,308
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,929
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,949
  1. Avatar for Wilko2 81. Wilko2 Lv 1 1 pt. 10,683
  2. Avatar for platinum9091 82. platinum9091 Lv 1 1 pt. 10,523
  3. Avatar for RockOn 83. RockOn Lv 1 1 pt. 10,204
  4. Avatar for nene liu 84. nene liu Lv 1 1 pt. 10,133
  5. Avatar for Pesky159 85. Pesky159 Lv 1 1 pt. 9,683
  6. Avatar for joshmiller 86. joshmiller Lv 1 1 pt. 8,949
  7. Avatar for bkoep 87. bkoep Lv 1 1 pt. 8,949

Comments