Placeholder image of a protein
Icon representing a puzzle

2194: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since over 3 years ago

Novice Overall Prediction

Summary


Created
September 01, 2022
Expires
Max points
100
Description

Note: This puzzle closes a day early, on September 7, due to a scheduled Foldit update.



This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for Foldit Staff 11. Foldit Staff 1 pt. 7,965

  1. Avatar for fiendish_ghoul 31. fiendish_ghoul Lv 1 14 pts. 10,707
  2. Avatar for NPrincipi 32. NPrincipi Lv 1 13 pts. 10,704
  3. Avatar for alcor29 33. alcor29 Lv 1 12 pts. 10,701
  4. Avatar for Skippysk8s 34. Skippysk8s Lv 1 11 pts. 10,693
  5. Avatar for ucad 35. ucad Lv 1 10 pts. 10,689
  6. Avatar for CharaLilith 36. CharaLilith Lv 1 10 pts. 10,678
  7. Avatar for zippyc137 37. zippyc137 Lv 1 9 pts. 10,670
  8. Avatar for infjamc 38. infjamc Lv 1 8 pts. 10,650
  9. Avatar for bamh 39. bamh Lv 1 7 pts. 10,648
  10. Avatar for Lotus23 40. Lotus23 Lv 1 7 pts. 10,638

Comments


LociOiling Lv 1

This puzzle would normally expire on Thursday in most US time zones. Instead, it expires on Wednesday, the same day as puzzle 2193.

The website also shows both 2193 and 2194 expiring at 16:00 UTC, which is not one of the normal times. Wednesday and Friday puzzles normally expire at 23:00 UTC, while Thursday puzzles expire at 18:00 UTC.

Another wrinkle is what's shown in the client when you hover over the puzzle title. Puzzle 2193 shows the normal date and time. The time is different than what's shown on the website.

Puzzle 2194 shows the same date and time on both the website and in the client. I guess there's something to be said for consistency.