Placeholder image of a protein
Icon representing a puzzle

2194: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since over 3 years ago

Novice Overall Prediction

Summary


Created
September 01, 2022
Expires
Max points
100
Description

Note: This puzzle closes a day early, on September 7, due to a scheduled Foldit update.



This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for Foldit Staff 11. Foldit Staff 1 pt. 7,965

  1. Avatar for Dr.Sillem 61. Dr.Sillem Lv 1 1 pt. 10,002
  2. Avatar for Merf 62. Merf Lv 1 1 pt. 9,993
  3. Avatar for dahast.de 63. dahast.de Lv 1 1 pt. 9,976
  4. Avatar for abiogenesis 64. abiogenesis Lv 1 1 pt. 9,801
  5. Avatar for Hellcat6 65. Hellcat6 Lv 1 1 pt. 9,788
  6. Avatar for Simek 66. Simek Lv 1 1 pt. 9,786
  7. Avatar for falma 67. falma Lv 1 1 pt. 9,755
  8. Avatar for Deleted player 68. Deleted player 1 pt. 9,720
  9. Avatar for Larini 69. Larini Lv 1 1 pt. 9,673
  10. Avatar for artsycook 70. artsycook Lv 1 1 pt. 9,634

Comments


LociOiling Lv 1

This puzzle would normally expire on Thursday in most US time zones. Instead, it expires on Wednesday, the same day as puzzle 2193.

The website also shows both 2193 and 2194 expiring at 16:00 UTC, which is not one of the normal times. Wednesday and Friday puzzles normally expire at 23:00 UTC, while Thursday puzzles expire at 18:00 UTC.

Another wrinkle is what's shown in the client when you hover over the puzzle title. Puzzle 2193 shows the normal date and time. The time is different than what's shown on the website.

Puzzle 2194 shows the same date and time on both the website and in the client. I guess there's something to be said for consistency.