Icon representing a puzzle

2200: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since over 3 years ago

Novice Novice Novice Overall Overall Overall Prediction Prediction Prediction

Summary


Created
September 15, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for CureCoin 11. CureCoin 1 pt. 10,276
  2. Avatar for UML BMEN.4100 12. UML BMEN.4100 1 pt. 9,386
  3. Avatar for Window Group 13. Window Group 1 pt. 9,121
  4. Avatar for RubiscoBobGroup 14. RubiscoBobGroup 1 pt. 9,086
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 9,086

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,696
  2. Avatar for MicElephant 2. MicElephant Lv 1 95 pts. 11,442
  3. Avatar for gmn 3. gmn Lv 1 90 pts. 11,437
  4. Avatar for Sandrix72 4. Sandrix72 Lv 1 85 pts. 11,429
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 80 pts. 11,404
  6. Avatar for Timo van der Laan 6. Timo van der Laan Lv 1 76 pts. 11,403
  7. Avatar for dcrwheeler 7. dcrwheeler Lv 1 72 pts. 11,391
  8. Avatar for Galaxie 8. Galaxie Lv 1 68 pts. 11,383
  9. Avatar for Aubade01 9. Aubade01 Lv 1 64 pts. 11,379
  10. Avatar for Punzi Baker 3 10. Punzi Baker 3 Lv 1 60 pts. 11,347

Comments