Icon representing a puzzle

2200: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since over 3 years ago

Novice Overall Prediction

Summary


Created
September 15, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,698
  2. Avatar for Contenders 2. Contenders 70 pts. 11,442
  3. Avatar for Go Science 3. Go Science 47 pts. 11,429
  4. Avatar for Void Crushers 4. Void Crushers 30 pts. 11,403
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 11,271
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 11 pts. 11,247
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 11,205
  8. Avatar for Gargleblasters 8. Gargleblasters 4 pts. 11,098
  9. Avatar for Australia 9. Australia 2 pts. 10,781
  10. Avatar for Ogre's lab 10. Ogre's lab 1 pt. 10,738

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,696
  2. Avatar for MicElephant 2. MicElephant Lv 1 95 pts. 11,442
  3. Avatar for gmn 3. gmn Lv 1 90 pts. 11,437
  4. Avatar for Sandrix72 4. Sandrix72 Lv 1 85 pts. 11,429
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 80 pts. 11,404
  6. Avatar for Timo van der Laan 6. Timo van der Laan Lv 1 76 pts. 11,403
  7. Avatar for dcrwheeler 7. dcrwheeler Lv 1 72 pts. 11,391
  8. Avatar for Galaxie 8. Galaxie Lv 1 68 pts. 11,383
  9. Avatar for Aubade01 9. Aubade01 Lv 1 64 pts. 11,379
  10. Avatar for Punzi Baker 3 10. Punzi Baker 3 Lv 1 60 pts. 11,347

Comments