Icon representing a puzzle

2200: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since over 3 years ago

Novice Overall Prediction

Summary


Created
September 15, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for CureCoin 11. CureCoin 1 pt. 10,276
  2. Avatar for UML BMEN.4100 12. UML BMEN.4100 1 pt. 9,386
  3. Avatar for Window Group 13. Window Group 1 pt. 9,121
  4. Avatar for RubiscoBobGroup 14. RubiscoBobGroup 1 pt. 9,086
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 9,086

  1. Avatar for g_b 11. g_b Lv 1 56 pts. 11,330
  2. Avatar for Bletchley Park 12. Bletchley Park Lv 1 53 pts. 11,317
  3. Avatar for BootsMcGraw 13. BootsMcGraw Lv 1 50 pts. 11,314
  4. Avatar for grogar7 14. grogar7 Lv 1 47 pts. 11,289
  5. Avatar for silent gene 15. silent gene Lv 1 44 pts. 11,284
  6. Avatar for fpc 16. fpc Lv 1 41 pts. 11,271
  7. Avatar for NPrincipi 17. NPrincipi Lv 1 39 pts. 11,257
  8. Avatar for drjr 18. drjr Lv 1 36 pts. 11,252
  9. Avatar for WBarme1234 19. WBarme1234 Lv 1 34 pts. 11,247
  10. Avatar for BackBuffer 20. BackBuffer Lv 1 32 pts. 11,234

Comments