Icon representing a puzzle

2200: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
September 15, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for CureCoin 11. CureCoin 1 pt. 10,276
  2. Avatar for UML BMEN.4100 12. UML BMEN.4100 1 pt. 9,386
  3. Avatar for Window Group 13. Window Group 1 pt. 9,121
  4. Avatar for RubiscoBobGroup 14. RubiscoBobGroup 1 pt. 9,086
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 9,086
  1. Avatar for guineapig 21. guineapig Lv 1 29 pts. 11,217
  2. Avatar for Idiotboy 22. Idiotboy Lv 1 27 pts. 11,208
  3. Avatar for NinjaGreg 23. NinjaGreg Lv 1 26 pts. 11,205
  4. Avatar for Alistair69 24. Alistair69 Lv 1 24 pts. 11,205
  5. Avatar for equilibria 25. equilibria Lv 1 22 pts. 11,186
  6. Avatar for infjamc 26. infjamc Lv 1 21 pts. 11,132
  7. Avatar for ucad 27. ucad Lv 1 19 pts. 11,126
  8. Avatar for Crossed Sticks 28. Crossed Sticks Lv 1 18 pts. 11,099
  9. Avatar for Pazithi 29. Pazithi Lv 1 16 pts. 11,098
  10. Avatar for stomjoh 30. stomjoh Lv 1 15 pts. 11,089

Comments