Icon representing a puzzle

2200: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since over 3 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
September 15, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,698
  2. Avatar for Contenders 2. Contenders 70 pts. 11,442
  3. Avatar for Go Science 3. Go Science 47 pts. 11,429
  4. Avatar for Void Crushers 4. Void Crushers 30 pts. 11,403
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 11,271
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 11 pts. 11,247
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 11,205
  8. Avatar for Gargleblasters 8. Gargleblasters 4 pts. 11,098
  9. Avatar for Australia 9. Australia 2 pts. 10,781
  10. Avatar for Ogre's lab 10. Ogre's lab 1 pt. 10,738

  1. Avatar for akaaka 31. akaaka Lv 1 14 pts. 11,077
  2. Avatar for maithra 32. maithra Lv 1 13 pts. 11,046
  3. Avatar for phi16 33. phi16 Lv 1 12 pts. 11,032
  4. Avatar for dettingen 34. dettingen Lv 1 11 pts. 11,028
  5. Avatar for heather-1 35. heather-1 Lv 1 10 pts. 11,019
  6. Avatar for Calimero Sombrero 36. Calimero Sombrero Lv 1 9 pts. 10,982
  7. Avatar for ProfVince 37. ProfVince Lv 1 9 pts. 10,964
  8. Avatar for SemperRabbit 38. SemperRabbit Lv 1 8 pts. 10,964
  9. Avatar for zippyc137 39. zippyc137 Lv 1 7 pts. 10,963
  10. Avatar for bamh 40. bamh Lv 1 7 pts. 10,955

Comments