Icon representing a puzzle

2200: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since over 3 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
September 15, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,698
  2. Avatar for Contenders 2. Contenders 70 pts. 11,442
  3. Avatar for Go Science 3. Go Science 47 pts. 11,429
  4. Avatar for Void Crushers 4. Void Crushers 30 pts. 11,403
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 11,271
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 11 pts. 11,247
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 11,205
  8. Avatar for Gargleblasters 8. Gargleblasters 4 pts. 11,098
  9. Avatar for Australia 9. Australia 2 pts. 10,781
  10. Avatar for Ogre's lab 10. Ogre's lab 1 pt. 10,738

  1. Avatar for Dr.Sillem 71. Dr.Sillem Lv 1 1 pt. 10,418
  2. Avatar for pruneau_44 72. pruneau_44 Lv 1 1 pt. 10,411
  3. Avatar for zbp 73. zbp Lv 1 1 pt. 10,393
  4. Avatar for lillliiillliiil 74. lillliiillliiil Lv 1 1 pt. 10,351
  5. Avatar for B. A. Beder 75. B. A. Beder Lv 1 1 pt. 10,326
  6. Avatar for kotenok2000 76. kotenok2000 Lv 1 1 pt. 10,276
  7. Avatar for Mohoernchen 77. Mohoernchen Lv 1 1 pt. 10,270
  8. Avatar for szakcsy 78. szakcsy Lv 1 1 pt. 10,246
  9. Avatar for em2103 79. em2103 Lv 1 1 pt. 10,215
  10. Avatar for mart0258 80. mart0258 Lv 1 1 pt. 10,209

Comments