Icon representing a puzzle

2206: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
September 29, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,089
  2. Avatar for Team China 12. Team China 1 pt. 9,722
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,679
  4. Avatar for BIOB101 - Discover Biology 14. BIOB101 - Discover Biology 1 pt. 9,678
  5. Avatar for RubiscoBobGroup 15. RubiscoBobGroup 1 pt. 9,608
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,746
  7. Avatar for Firesign 17. Firesign 1 pt. 8,717
  1. Avatar for Larini 61. Larini Lv 1 1 pt. 10,191
  2. Avatar for Hellcat6 62. Hellcat6 Lv 1 1 pt. 10,171
  3. Avatar for vyndaquel 63. vyndaquel Lv 1 1 pt. 10,136
  4. Avatar for Dr.Sillem 64. Dr.Sillem Lv 1 1 pt. 10,123
  5. Avatar for Deleted player 65. Deleted player 1 pt. 10,121
  6. Avatar for MirsadaH 66. MirsadaH Lv 1 1 pt. 10,089
  7. Avatar for wosser1 67. wosser1 Lv 1 1 pt. 10,043
  8. Avatar for Mohoernchen 68. Mohoernchen Lv 1 1 pt. 10,022
  9. Avatar for rinze 69. rinze Lv 1 1 pt. 9,935
  10. Avatar for BNet 70. BNet Lv 1 1 pt. 9,892

Comments