2206: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since over 3 years ago

Summary

• Created: September 29, 2022
• Expires: October 06, 2022 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

• Sequence: GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups

• 1. Anthropic Dreams 100 pts. 11,884
• 2. Go Science 73 pts. 11,499
• 3. FamilyBarmettler 52 pts. 11,483
• 4. Contenders 36 pts. 11,473
• 5. Gargleblasters 24 pts. 11,372
• 6. L'Alliance Francophone 16 pts. 11,258
• 7. Marvin's bunch 10 pts. 11,224
• 8. Australia 6 pts. 10,951
• 9. Czech National Team 4 pts. 10,475
• 10. Trinity Biology 2 pts. 10,301

Top soloists

• 61. Larini 1 pt. 10,191
• 62. Hellcat6 1 pt. 10,171
• 63. vyndaquel 1 pt. 10,136
• 64. Dr.Sillem 1 pt. 10,123
• 65. Deleted player 1 pt. 10,121
• 66. MirsadaH 1 pt. 10,089
• 67. wosser1 1 pt. 10,043
• 68. Mohoernchen 1 pt. 10,022
• 69. rinze 1 pt. 9,935
• 70. BNet 1 pt. 9,892

Comments

[LociOiling]

The usual stuff: https://foldit.fandom.com/wiki/Revisiting_puzzle/153:_Rosetta_Decoy_13