Icon representing a puzzle

2206: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
September 29, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,089
  2. Avatar for Team China 12. Team China 1 pt. 9,722
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,679
  4. Avatar for BIOB101 - Discover Biology 14. BIOB101 - Discover Biology 1 pt. 9,678
  5. Avatar for RubiscoBobGroup 15. RubiscoBobGroup 1 pt. 9,608
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,746
  7. Avatar for Firesign 17. Firesign 1 pt. 8,717
  1. Avatar for zbp 71. zbp Lv 1 1 pt. 9,891
  2. Avatar for lillliiillliiil 72. lillliiillliiil Lv 1 1 pt. 9,832
  3. Avatar for pruneau_44 73. pruneau_44 Lv 1 1 pt. 9,825
  4. Avatar for B. A. Beder 74. B. A. Beder Lv 1 1 pt. 9,795
  5. Avatar for futsall 75. futsall Lv 1 1 pt. 9,782
  6. Avatar for SuoFeng 76. SuoFeng Lv 1 1 pt. 9,722
  7. Avatar for Eannestay 77. Eannestay Lv 1 1 pt. 9,691
  8. Avatar for furi0us 78. furi0us Lv 1 1 pt. 9,679
  9. Avatar for molleke 79. molleke Lv 1 1 pt. 9,679
  10. Avatar for AnnieGreen 80. AnnieGreen Lv 1 1 pt. 9,678

Comments