Icon representing a puzzle

2206: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
September 29, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,884
  2. Avatar for Go Science 2. Go Science 73 pts. 11,499
  3. Avatar for FamilyBarmettler 3. FamilyBarmettler 52 pts. 11,483
  4. Avatar for Contenders 4. Contenders 36 pts. 11,473
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 11,372
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 11,258
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 11,224
  8. Avatar for Australia 8. Australia 6 pts. 10,951
  9. Avatar for Czech National Team 9. Czech National Team 4 pts. 10,475
  10. Avatar for Trinity Biology 10. Trinity Biology 2 pts. 10,301
  1. Avatar for zbp 71. zbp Lv 1 1 pt. 9,891
  2. Avatar for lillliiillliiil 72. lillliiillliiil Lv 1 1 pt. 9,832
  3. Avatar for pruneau_44 73. pruneau_44 Lv 1 1 pt. 9,825
  4. Avatar for B. A. Beder 74. B. A. Beder Lv 1 1 pt. 9,795
  5. Avatar for futsall 75. futsall Lv 1 1 pt. 9,782
  6. Avatar for SuoFeng 76. SuoFeng Lv 1 1 pt. 9,722
  7. Avatar for Eannestay 77. Eannestay Lv 1 1 pt. 9,691
  8. Avatar for furi0us 78. furi0us Lv 1 1 pt. 9,679
  9. Avatar for molleke 79. molleke Lv 1 1 pt. 9,679
  10. Avatar for AnnieGreen 80. AnnieGreen Lv 1 1 pt. 9,678

Comments