Icon representing a puzzle

2209: Electron Density Reconstruction 14

Closed since over 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 29, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
ITRTISKAKGPPRIPEVYLLPPPRNELSKKKVSLTCMITGFYPADINVEWDSSEPSDYKNTPPVFDTDGSFFLYSRLKVDTDAWNNGESFTCSVMHEALPNHVIQKSISRSPG

Top groups

  1. Avatar for RubiscoBobGroup 11. RubiscoBobGroup 1 pt. 10,329
  2. Avatar for Coastal Biochemistry 12. Coastal Biochemistry 1 pt. 8,930
  3. Avatar for CH4110 Fold it! 13. CH4110 Fold it! 1 pt. 6,883
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 0
  5. Avatar for Firesign 15. Firesign 1 pt. 0
  1. Avatar for Alistair69 51. Alistair69 Lv 1 2 pts. 12,561
  2. Avatar for abiogenesis 52. abiogenesis Lv 1 2 pts. 12,515
  3. Avatar for hada 53. hada Lv 1 2 pts. 12,508
  4. Avatar for alcor29 54. alcor29 Lv 1 1 pt. 12,310
  5. Avatar for rezaefar 55. rezaefar Lv 1 1 pt. 12,121
  6. Avatar for Dr.Sillem 56. Dr.Sillem Lv 1 1 pt. 11,847
  7. Avatar for Gonegirl 57. Gonegirl Lv 1 1 pt. 11,846
  8. Avatar for argyrw 58. argyrw Lv 1 1 pt. 11,829
  9. Avatar for Oransche 59. Oransche Lv 1 1 pt. 11,812
  10. Avatar for Wiz kid 60. Wiz kid Lv 1 1 pt. 11,628

Comments