Icon representing a puzzle

2209: Electron Density Reconstruction 14

Closed since over 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 29, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
ITRTISKAKGPPRIPEVYLLPPPRNELSKKKVSLTCMITGFYPADINVEWDSSEPSDYKNTPPVFDTDGSFFLYSRLKVDTDAWNNGESFTCSVMHEALPNHVIQKSISRSPG

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 14,470
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 14,431
  3. Avatar for Contenders 3. Contenders 47 pts. 14,304
  4. Avatar for Gargleblasters 4. Gargleblasters 30 pts. 14,080
  5. Avatar for Void Crushers 5. Void Crushers 19 pts. 13,893
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 13,874
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 13,710
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 4 pts. 13,416
  9. Avatar for Russian team 9. Russian team 2 pts. 12,917
  10. Avatar for Australia 10. Australia 1 pt. 12,869
  1. Avatar for Alistair69 51. Alistair69 Lv 1 2 pts. 12,561
  2. Avatar for abiogenesis 52. abiogenesis Lv 1 2 pts. 12,515
  3. Avatar for hada 53. hada Lv 1 2 pts. 12,508
  4. Avatar for alcor29 54. alcor29 Lv 1 1 pt. 12,310
  5. Avatar for rezaefar 55. rezaefar Lv 1 1 pt. 12,121
  6. Avatar for Dr.Sillem 56. Dr.Sillem Lv 1 1 pt. 11,847
  7. Avatar for Gonegirl 57. Gonegirl Lv 1 1 pt. 11,846
  8. Avatar for argyrw 58. argyrw Lv 1 1 pt. 11,829
  9. Avatar for Oransche 59. Oransche Lv 1 1 pt. 11,812
  10. Avatar for Wiz kid 60. Wiz kid Lv 1 1 pt. 11,628

Comments