Icon representing a puzzle

2215: Revisiting Puzzle 52: Bacteria Energy

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
October 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for RubiscoBobGroup 11. RubiscoBobGroup 1 pt. 9,942
  2. Avatar for Team China 12. Team China 1 pt. 9,752
  3. Avatar for Window Group 13. Window Group 1 pt. 7,735
  1. Avatar for BootsMcGraw 31. BootsMcGraw Lv 1 13 pts. 10,797
  2. Avatar for fiendish_ghoul 32. fiendish_ghoul Lv 1 12 pts. 10,754
  3. Avatar for NickDanger 33. NickDanger Lv 1 11 pts. 10,753
  4. Avatar for Alistair69 34. Alistair69 Lv 1 10 pts. 10,748
  5. Avatar for zippyc137 35. zippyc137 Lv 1 9 pts. 10,746
  6. Avatar for Komeiji_Koishi 36. Komeiji_Koishi Lv 1 8 pts. 10,739
  7. Avatar for stomjoh 37. stomjoh Lv 1 8 pts. 10,733
  8. Avatar for ProfVince 38. ProfVince Lv 1 7 pts. 10,709
  9. Avatar for heather-1 39. heather-1 Lv 1 6 pts. 10,690
  10. Avatar for Oransche 40. Oransche Lv 1 6 pts. 10,670

Comments