Icon representing a puzzle

2215: Revisiting Puzzle 52: Bacteria Energy

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
October 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for RubiscoBobGroup 11. RubiscoBobGroup 1 pt. 9,942
  2. Avatar for Team China 12. Team China 1 pt. 9,752
  3. Avatar for Window Group 13. Window Group 1 pt. 7,735
  1. Avatar for kentish_alex 51. kentish_alex Lv 1 2 pts. 10,487
  2. Avatar for Silvercraft 52. Silvercraft Lv 1 2 pts. 10,477
  3. Avatar for abiogenesis 53. abiogenesis Lv 1 2 pts. 10,453
  4. Avatar for Merf 54. Merf Lv 1 1 pt. 10,441
  5. Avatar for Wiz kid 55. Wiz kid Lv 1 1 pt. 10,436
  6. Avatar for pizpot 56. pizpot Lv 1 1 pt. 10,361
  7. Avatar for heyubob 57. heyubob Lv 1 1 pt. 10,340
  8. Avatar for Vinara 58. Vinara Lv 1 1 pt. 10,328
  9. Avatar for AlphaFold2 59. AlphaFold2 Lv 1 1 pt. 10,256
  10. Avatar for Arne Heessels 60. Arne Heessels Lv 1 1 pt. 10,249

Comments