Icon representing a puzzle

2215: Revisiting Puzzle 52: Bacteria Energy

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
October 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for RubiscoBobGroup 11. RubiscoBobGroup 1 pt. 9,942
  2. Avatar for Team China 12. Team China 1 pt. 9,752
  3. Avatar for Window Group 13. Window Group 1 pt. 7,735
  1. Avatar for zo3xiaJonWeinberg 81. zo3xiaJonWeinberg Lv 1 1 pt. 9,752
  2. Avatar for georg137 82. georg137 Lv 1 1 pt. 9,706
  3. Avatar for antibot215 83. antibot215 Lv 1 1 pt. 9,481
  4. Avatar for falma 84. falma Lv 1 1 pt. 9,405
  5. Avatar for jflat06 85. jflat06 Lv 1 1 pt. 7,735
  6. Avatar for spvincent 86. spvincent Lv 1 1 pt. 0
  7. Avatar for robgee 87. robgee Lv 1 1 pt. 0
  8. Avatar for pr0tfold 88. pr0tfold Lv 1 1 pt. 0
  9. Avatar for kevin everington 89. kevin everington Lv 1 1 pt. 0

Comments